PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009137614.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 957aa    MW: 105460 Da    PI: 5.5227
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009137614.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.94.9e-29586636252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     ek+isl++l++yF +++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rkik++
  XP_009137614.1 586 EKTISLDVLQQYFTGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKIKKV 636
                     799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF557813.04E-5209280IPR029016GAF domain-like
PROSITE profilePS5151917.393575656IPR003035RWP-RK domain
PfamPF020427.3E-26588636IPR003035RWP-RK domain
SuperFamilySSF542773.27E-23857945No hitNo description
PfamPF005646.5E-20861942IPR000270PB1 domain
PROSITE profilePS5174527.384861943IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.2E-27861943No hitNo description
SMARTSM006662.8E-28861943IPR000270PB1 domain
CDDcd064075.41E-34862942No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 957 aa     Download sequence    Send to blast
MCEPDDNTAR NGATPPPSRS REVLMDVDDL DLDGSWPLDQ IPYLSSSNRM ISPLFVSSSS  60
EQPCSPLWAF SDVGGAVNHG GDDEKISSAS GVPSFRLADY PLFLPYSSSP SVAENTLEKH  120
NGFQFPSPLM SLVPPENTDN YCVIKERMTQ ALRYFKESTE QHVLAQVWAP VRKNGRDLLT  180
TLGQPFVLNP NGNGLNQYRM ISLTYMFSVD SESDIELGLP GRVFRQKLPE WTPNVQYYSS  240
KEFSRLDHAL HYNVRGTLAL PVFNPSGESC IGVVELIMTS EKIHYAPEVD RVCKALEAVN  300
LKSSEILDHQ TTQICNESRQ NALAEILEVL TVVCETHNLP LAQTWVPCQH GSVLANGGGL  360
KKNCTSFDGS CMGQVCMSTT DMACYVVDAH VWGFRDACLE HHLQKGQGVA GRAFLNGGSC  420
FCRDITKFCK TQYPLVHYAL MFKLTTCFAI SLQSSYTGDD SYILEFFLPS SMTDNQEQDS  480
LLGSLLVTMK EHFQSLRVAS GVDFGEDDDK LSFEIIQALP DEKIHSEIES IRVPFSGFKS  540
NATETLLIPQ PAVQSSAPVN GKTNVATVNG VVKEKKKTEK KRGKTEKTIS LDVLQQYFTG  600
SLKDAAKSLG VCPTTMKRIC RQHGISRWPS RKIKKVNRSI TKLKRVIESV QCTDGGLDLT  660
SMAVSSIPWT HGQTAAHPLN SPNGSKPPEL PTTNNSPNHW SSDHHSPPEP NGSPELPSNG  720
HKRSRTGDES AGTPTSHGSC DGNQLDETKV PNQDPLFTVG GPPGLFFPPY SRDHDVSAAS  780
FAMPNRLLGT IDHFRGMPIE DAGSSKDLRN LCSTAAFDDK FPDSNWMNND NNSNNNMYAP  840
PKEEEVANIT REPPSGSEMR TVTIKASYKE DIIRFRISSG SGIMELKDEV AKRLRLDAGT  900
FDIKYLDDDN EWVLIACDAD LQECLEIPRS SRTNVVRLLV HDVTANLGSS CESTGEL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2284520.0AK228452.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL15-03-P13.
GenBankBT0057760.0BT005776.1 Arabidopsis thaliana clone RAFL15-03-P13 (R20174) unknown protein (At4g24020) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009137614.10.0PREDICTED: protein NLP7
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLM4DB940.0M4DB94_BRARP; Uncharacterized protein
STRINGBra013754.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25072666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7